Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10027437
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family HD-ZIP
Protein Properties Length: 755aa    MW: 83263.7 Da    PI: 5.0803
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10027437genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++k +++t+ q++eLe+ F+++++p++++r eL++klgL++rq+k+WFqNrR++ k
                  79999***********************************************9987 PP

        START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                  +a++a++el+ +++ +ep+W+k +       e++n de+ ++ +++ +     + +ea+r++g v  ++  lve l+d++ +W  t+     + +++e
                  5789***************************************99888999999**************************.99999999999****** PP

        START  84 vissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                  vis g       g+lqlm+a+lq++splvp R   f+R+++q ++g+w++vdvS+ +  + ++s s+  + +lpSg++i++++ng+skvtwveh +++
                  *************************************************************99889999999************************** PP

        START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                  + ++h +l+++++sg  +ga +w++tlqr+ce+
                  *******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.94550110IPR001356Homeobox domain
SMARTSM003891.5E-1852114IPR001356Homeobox domain
PfamPF000461.3E-1753108IPR001356Homeobox domain
CDDcd000869.22E-2053110No hitNo description
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PROSITE profilePS5084839.036242482IPR002913START domain
SuperFamilySSF559612.53E-27245480No hitNo description
CDDcd088751.72E-96246478No hitNo description
SMARTSM002345.9E-36251479IPR002913START domain
PfamPF018522.6E-44252479IPR002913START domain
SuperFamilySSF559611.76E-15512748No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090292.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
RefseqXP_012090293.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
TrEMBLA0A067JEK70.0A0A067JEK7_JATCU; Uncharacterized protein
STRINGGLYMA18G45970.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1